Potential Serum Markers for Monitoring the Progression of Hepatitis B Virus-Associated Chronic Hepatic Lesions to Liver Cirrhosis.

Wu C, Liu L, Zhao P, Tang D, Yao D, Zhu L, Wang Z - Gut Liver (2015)

Bottom Line: Using SELDI-TOF MS, serum protein/peptide profiles on the CM10 ProteinChip arrays were obtained from a training group including 26 HBV-associated hepatocellular carcinoma patients with liver cirrhosis (LC), 30 HBV-associated LC patients, 85 patients at different stages of liver fibrosis, and 30 asymptomatic HBV carriers.A SELDI peak of M/Z 5805 with value for predicting LC in HBV-infected patients was found and was identified as a peptide of the C-terminal fraction of the fibrinogen a-chain precursor, isoform 1.The peptide of the C-terminal fraction of the fibrinogen α-chain precursor, isoform 1 with M/Z 5805, may be a serological biomarker for progression to LC in HBV-infected patients.

View Article: PubMed Central - PubMed

Affiliation: Department of Digestive Endoscopy, Division of Southern Building, Chinese PLA General Hospital, Beijing,China.


Background/aims: To screen for serum protein/peptide biomarkers of hepatitis B virus (HBV)-associated chronic hepatic lesions in an attempt to profile the progression of HBV-associated chronic hepatic lesions using surface-enhanced laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF MS) techniques.

Methods: Using SELDI-TOF MS, serum protein/peptide profiles on the CM10 ProteinChip arrays were obtained from a training group including 26 HBV-associated hepatocellular carcinoma patients with liver cirrhosis (LC), 30 HBV-associated LC patients, 85 patients at different stages of liver fibrosis, and 30 asymptomatic HBV carriers. The most valuable SELDI peak for predicting the progression to LC in HBV-infected patients was identified.

Results: A SELDI peak of M/Z 5805 with value for predicting LC in HBV-infected patients was found and was identified as a peptide of the C-terminal fraction of the fibrinogen a-chain precursor, isoform 1.

Conclusions: The peptide of the C-terminal fraction of the fibrinogen α-chain precursor, isoform 1 with M/Z 5805, may be a serological biomarker for progression to LC in HBV-infected patients.

No MeSH data available.

Related in: MedlinePlus

Some of the LC-MS/MS data of the extracted, highly expressed 5805 Da solution. The X-axis shows the m/z of the peaks, and the Y-axis shows the relative abundance of the b/y ion match map.
© Copyright Policy
Related In: Results  -  Collection


f4-gnl-09-665: Some of the LC-MS/MS data of the extracted, highly expressed 5805 Da solution. The X-axis shows the m/z of the peaks, and the Y-axis shows the relative abundance of the b/y ion match map.

Mentions: The two purification steps were chosen to identify the protein or peptide 5805. First the sera of ten patients whose sera expressed high intensity 5805 Da peak were mixed to extract 5805 fraction by using the WCX Chromatography magnetic beads. The mass spectrum of the solutions was showed in Fig. 3. Then the solutions containing extracted 5805 Da fraction were further analyzed to reveal their identities using online liquid chromatography-tandem mass spectrometry (LC-MS/MS). Database searching identified the 5805 Da peak to be a C-terminal fraction of fibrinogen α-chain precursor, isoform 1 (SSSYSKQFTSSTS-YNRGDSTFESKSYKMADEAGSEADHEGTH-STKRGHAKSRPV). The one of mass spectrum of LC-MS/MS was showed in Fig. 4.

Potential Serum Markers for Monitoring the Progression of Hepatitis B Virus-Associated Chronic Hepatic Lesions to Liver Cirrhosis.

Wu C, Liu L, Zhao P, Tang D, Yao D, Zhu L, Wang Z - Gut Liver (2015)

Some of the LC-MS/MS data of the extracted, highly expressed 5805 Da solution. The X-axis shows the m/z of the peaks, and the Y-axis shows the relative abundance of the b/y ion match map.
© Copyright Policy
Related In: Results  -  Collection

Show All Figures

f4-gnl-09-665: Some of the LC-MS/MS data of the extracted, highly expressed 5805 Da solution. The X-axis shows the m/z of the peaks, and the Y-axis shows the relative abundance of the b/y ion match map.
Mentions: The two purification steps were chosen to identify the protein or peptide 5805. First the sera of ten patients whose sera expressed high intensity 5805 Da peak were mixed to extract 5805 fraction by using the WCX Chromatography magnetic beads. The mass spectrum of the solutions was showed in Fig. 3. Then the solutions containing extracted 5805 Da fraction were further analyzed to reveal their identities using online liquid chromatography-tandem mass spectrometry (LC-MS/MS). Database searching identified the 5805 Da peak to be a C-terminal fraction of fibrinogen α-chain precursor, isoform 1 (SSSYSKQFTSSTS-YNRGDSTFESKSYKMADEAGSEADHEGTH-STKRGHAKSRPV). The one of mass spectrum of LC-MS/MS was showed in Fig. 4.

Bottom Line: Using SELDI-TOF MS, serum protein/peptide profiles on the CM10 ProteinChip arrays were obtained from a training group including 26 HBV-associated hepatocellular carcinoma patients with liver cirrhosis (LC), 30 HBV-associated LC patients, 85 patients at different stages of liver fibrosis, and 30 asymptomatic HBV carriers.A SELDI peak of M/Z 5805 with value for predicting LC in HBV-infected patients was found and was identified as a peptide of the C-terminal fraction of the fibrinogen a-chain precursor, isoform 1.The peptide of the C-terminal fraction of the fibrinogen α-chain precursor, isoform 1 with M/Z 5805, may be a serological biomarker for progression to LC in HBV-infected patients.

View Article: PubMed Central - PubMed

Affiliation: Department of Digestive Endoscopy, Division of Southern Building, Chinese PLA General Hospital, Beijing,China.


Background/aims: To screen for serum protein/peptide biomarkers of hepatitis B virus (HBV)-associated chronic hepatic lesions in an attempt to profile the progression of HBV-associated chronic hepatic lesions using surface-enhanced laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF MS) techniques.

Methods: Using SELDI-TOF MS, serum protein/peptide profiles on the CM10 ProteinChip arrays were obtained from a training group including 26 HBV-associated hepatocellular carcinoma patients with liver cirrhosis (LC), 30 HBV-associated LC patients, 85 patients at different stages of liver fibrosis, and 30 asymptomatic HBV carriers. The most valuable SELDI peak for predicting the progression to LC in HBV-infected patients was identified.

Results: A SELDI peak of M/Z 5805 with value for predicting LC in HBV-infected patients was found and was identified as a peptide of the C-terminal fraction of the fibrinogen a-chain precursor, isoform 1.

Conclusions: The peptide of the C-terminal fraction of the fibrinogen α-chain precursor, isoform 1 with M/Z 5805, may be a serological biomarker for progression to LC in HBV-infected patients.

No MeSH data available.

Related in: MedlinePlus