Biochemical, biophysical and IgE-epitope characterization of the wheat food allergen, Tri a 37.

Pahr S, Selb R, Weber M, Focke-Tejkl M, Hofer G, Dordić A, Keller W, Papadopoulos NG, Giavi S, Mäkelä M, Pelkonen A, Niederberger V, Vrtala S, Valenta R - PLoS ONE (2014)

Bottom Line: Reactivity to Tri a 37 does not require a folded protein and the presence of sequential IgE epitopes indicates that sensitization to alpha-purothionin occurs via the gut.Both allergens can be used for in-vitro diagnosis of wheat food allergy.The induction of blocking IgG antibodies suggests the usefulness for immunotherapy.

View Article: PubMed Central - PubMed

Affiliation: Division of Immunopathology, Department of Pathophysiology and Allergy Research, Center of Pathophysiology, Infectiology and Immunology, Medical University of Vienna, Vienna, Austria; Christian Doppler Laboratory for the Development of Allergen Chips, Medical University of Vienna, Vienna, Austria.

Wheat is an important staple food and potent allergen source. Recently, we isolated a cDNA coding for wheat alpha-purothionin which is recognized by wheat food allergic patients at risk for severe wheat-induced allergy. The purpose of the present study was the biochemical, biophysical and IgE epitope characterization of recombinant alpha-purothionin. Synthetic genes coding for alpha-purothionin were expressed in a prokaryotic system using Escherichia coli and in a eukaryotic expression system based on baculovirus-infected Sf9-insect cells. Recombinant proteins were purified and characterized by SDS-PAGE, mass spectrometry, circular dichroism, chemical cross-linking and size exclusion chromatography. Five overlapping peptide were synthesized for epitope mapping. Alpha-purothionin-specific rabbit antibodies were raised to perform IgE-inhibition experiments and to study the resistance to digestion. The IgE reactivity of the proteins and peptides from ten wheat food allergic patients was studied in non-denaturing RAST-based binding assays. Alpha-purothionin was expressed in the prokaryotic (EcTri a 37) and in the eukaryotic system (BvTri a 37) as a soluble and monomeric protein. However, circular dichroism analysis revealed that EcTri a 37 was unfolded whereas BvTri a 37 was a folded protein. Both proteins showed comparable IgE-reactivity and the epitope mapping revealed the presence of sequential IgE epitopes in the N-terminal basic thionin domain (peptide1:KSCCRSTLGRNCYNLCRARGAQKLCAGVCR) and in the C-terminal acidic extension domain (peptide3:KGFPKLALESNSDEPDTIEYCNLGCRSSVC, peptide4:CNLGCRSSVCDYMVNAAADDEEMKLYVEN). Natural Tri a 37 was digested under gastric conditions but resistant to duodenal digestion. Immunization with EcTri a 37 induced IgG antibodies which recognized similar epitopes as IgE antibodies from allergic patients and inhibited allergic patients' IgE binding. Reactivity to Tri a 37 does not require a folded protein and the presence of sequential IgE epitopes indicates that sensitization to alpha-purothionin occurs via the gut. Both allergens can be used for in-vitro diagnosis of wheat food allergy. The induction of blocking IgG antibodies suggests the usefulness for immunotherapy.

Show MeSH

Related in: MedlinePlus

Inhibition of allergic patients' IgE binding to Tri a 37 by rabbit anti-Tri a 37 antibodies.Tri a 37 was tested for IgE reactivity with sera from three Tri a 37-allergic patients (1, 3, 4), serum from a non-allergic individual or buffer after pre-incubation with rabbit anti-Tri a 37 antibodies (Immune) or the rabbits pre-immune serum (Pre). Shown are the optical density (O.D.) levels corresponding to bound IgE.
© Copyright Policy
Related In: Results  -  Collection


pone-0111483-g004: Inhibition of allergic patients' IgE binding to Tri a 37 by rabbit anti-Tri a 37 antibodies.Tri a 37 was tested for IgE reactivity with sera from three Tri a 37-allergic patients (1, 3, 4), serum from a non-allergic individual or buffer after pre-incubation with rabbit anti-Tri a 37 antibodies (Immune) or the rabbits pre-immune serum (Pre). Shown are the optical density (O.D.) levels corresponding to bound IgE.

Mentions: EcTri a 37- specific rabbit IgG antibodies were then used to investigate their ability to inhibit wheat food allergic patients' IgE binding (Table 1; Patient 1, 3, 4) to the allergen in ELISA competition experiments. In patients 3 and 4 who showed the strongest IgE binding to Tri a 37, rabbit anti-Tri a 37 antibodies caused a 64% and 73% inhibition of IgE binding respectively whereas the inhibition in patient 1 who showed low levels of Tri a 37-specific IgE was 39% (Figure 4).

Biochemical, biophysical and IgE-epitope characterization of the wheat food allergen, Tri a 37.

Pahr S, Selb R, Weber M, Focke-Tejkl M, Hofer G, Dordić A, Keller W, Papadopoulos NG, Giavi S, Mäkelä M, Pelkonen A, Niederberger V, Vrtala S, Valenta R - PLoS ONE (2014)

Inhibition of allergic patients' IgE binding to Tri a 37 by rabbit anti-Tri a 37 antibodies.Tri a 37 was tested for IgE reactivity with sera from three Tri a 37-allergic patients (1, 3, 4), serum from a non-allergic individual or buffer after pre-incubation with rabbit anti-Tri a 37 antibodies (Immune) or the rabbits pre-immune serum (Pre). Shown are the optical density (O.D.) levels corresponding to bound IgE.
© Copyright Policy
Related In: Results  -  Collection

Show All Figures

pone-0111483-g004: Inhibition of allergic patients' IgE binding to Tri a 37 by rabbit anti-Tri a 37 antibodies.Tri a 37 was tested for IgE reactivity with sera from three Tri a 37-allergic patients (1, 3, 4), serum from a non-allergic individual or buffer after pre-incubation with rabbit anti-Tri a 37 antibodies (Immune) or the rabbits pre-immune serum (Pre). Shown are the optical density (O.D.) levels corresponding to bound IgE.
Mentions: EcTri a 37- specific rabbit IgG antibodies were then used to investigate their ability to inhibit wheat food allergic patients' IgE binding (Table 1; Patient 1, 3, 4) to the allergen in ELISA competition experiments. In patients 3 and 4 who showed the strongest IgE binding to Tri a 37, rabbit anti-Tri a 37 antibodies caused a 64% and 73% inhibition of IgE binding respectively whereas the inhibition in patient 1 who showed low levels of Tri a 37-specific IgE was 39% (Figure 4).

Bottom Line: Reactivity to Tri a 37 does not require a folded protein and the presence of sequential IgE epitopes indicates that sensitization to alpha-purothionin occurs via the gut.Both allergens can be used for in-vitro diagnosis of wheat food allergy.The induction of blocking IgG antibodies suggests the usefulness for immunotherapy.

View Article: PubMed Central - PubMed

Affiliation: Division of Immunopathology, Department of Pathophysiology and Allergy Research, Center of Pathophysiology, Infectiology and Immunology, Medical University of Vienna, Vienna, Austria; Christian Doppler Laboratory for the Development of Allergen Chips, Medical University of Vienna, Vienna, Austria.

Wheat is an important staple food and potent allergen source. Recently, we isolated a cDNA coding for wheat alpha-purothionin which is recognized by wheat food allergic patients at risk for severe wheat-induced allergy. The purpose of the present study was the biochemical, biophysical and IgE epitope characterization of recombinant alpha-purothionin. Synthetic genes coding for alpha-purothionin were expressed in a prokaryotic system using Escherichia coli and in a eukaryotic expression system based on baculovirus-infected Sf9-insect cells. Recombinant proteins were purified and characterized by SDS-PAGE, mass spectrometry, circular dichroism, chemical cross-linking and size exclusion chromatography. Five overlapping peptide were synthesized for epitope mapping. Alpha-purothionin-specific rabbit antibodies were raised to perform IgE-inhibition experiments and to study the resistance to digestion. The IgE reactivity of the proteins and peptides from ten wheat food allergic patients was studied in non-denaturing RAST-based binding assays. Alpha-purothionin was expressed in the prokaryotic (EcTri a 37) and in the eukaryotic system (BvTri a 37) as a soluble and monomeric protein. However, circular dichroism analysis revealed that EcTri a 37 was unfolded whereas BvTri a 37 was a folded protein. Both proteins showed comparable IgE-reactivity and the epitope mapping revealed the presence of sequential IgE epitopes in the N-terminal basic thionin domain (peptide1:KSCCRSTLGRNCYNLCRARGAQKLCAGVCR) and in the C-terminal acidic extension domain (peptide3:KGFPKLALESNSDEPDTIEYCNLGCRSSVC, peptide4:CNLGCRSSVCDYMVNAAADDEEMKLYVEN). Natural Tri a 37 was digested under gastric conditions but resistant to duodenal digestion. Immunization with EcTri a 37 induced IgG antibodies which recognized similar epitopes as IgE antibodies from allergic patients and inhibited allergic patients' IgE binding. Reactivity to Tri a 37 does not require a folded protein and the presence of sequential IgE epitopes indicates that sensitization to alpha-purothionin occurs via the gut. Both allergens can be used for in-vitro diagnosis of wheat food allergy. The induction of blocking IgG antibodies suggests the usefulness for immunotherapy.

Show MeSH
Related in: MedlinePlus